« Return to Thread: blastall problem

Re: blastall problem

by Jason Stajich-3 :: Rate this Message:

Reply to Author | View in Thread

When/How are are you writing your sequences to this file result.faa?  are you using seqIO or bioperl to write the sequence  to a file?  
I'm wondering if this is I/O buffering problem. 

On Apr 5, 2007, at 8:26 PM, DeeGee wrote:


hi Torsten,  
blastall -p blastp -i result/fasta.faa -d /export/home/database/nr works
perfectly fine on the command line, and the 'fasta.faa' is in fasta format:

gi|18676474|dbj|BAB84889.1| FLJ00134 protein [Homo sapiens]
HLSAQKASVGPESVSGLGTRTWPRVSCEVTVQCWPGCHLKVGGFKMAPWQGVGRRPWFLTWGPLCGAASVSPSMTVASSQ
QGWDCTAGRRWLGEGEIEALAQVSEFKTVLSFQGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPA
PGDSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRHR
DTHPGSPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIHGRAAAS
AQGAVAPGPDGGGPFPPWPLG

it seems like i'm just one bloody step away from success. ^ ^* can't figure
out the prob. 
thanks for your help.


Torsten Seemann wrote:

Dorjee,

thanks alot for your reply again. as per your suggestion (using 'die
"could
not get seq" if not defined $queryin;'), i now get the following error
message:
Software error:
could not get seq at /usr/local/apache2/htdocs/remote_ncbi.pl line 50.
i've attached the script. could you plz have a look at it and see where
am i
going wrong.
cheers mate!

This strongly suggests that your FASTA file is not actually in FASTA
format.

Does it work if you pass it to blastall on the command line?
eg. blastall -p blastp -i result/fasta.faa -d /export/home/database/nr

Saier Lab.
858-534-2457

Are you working at UCSD?

--Torsten
_______________________________________________
Bioperl-l mailing list



-- 
Sent from the Perl - Bioperl-L mailing list archive at Nabble.com.

_______________________________________________
Bioperl-l mailing list

--
Jason Stajich 
Miller Research Fellow
University of California, Berkeley
lab: 510.642.8441
http://fungalgenomes.org/



_______________________________________________
Bioperl-l mailing list
Bioperl-l@...
http://lists.open-bio.org/mailman/listinfo/bioperl-l

smime.p7s (3K) Download Attachment

 « Return to Thread: blastall problem