« Return to Thread: different results with remote-blast skript

Re: cdd-search with remoteblast?

by Cook, Malcolm-2 :: Rate this Message:

Reply to Author | View in Thread

Jonas,

If you want to continue to use the bioperl remoteblast interface, probably what you should do is simply call it twice.

Once, as you already know how to do, which will return without CDD results.

Secondly, to get the CDD results, call remoteblast a second time.  This time, using
-database => 'CDD'
-program => 'rpsblast'

However, the wrapper may object to the 'rpsblast' program.  It is not listed in the POD - http://search.cpan.org/~cjfields/BioPerl-1.6.0/Bio/Tools/Run/RemoteBlast.pm)   If so, my guess is that changing the perl wrapper to allow rpsblast will "just work" (tm).  I've cc:ed cjfields@... for his opinion on this.

Also, you might want to perform the CDD search first, especially if you are streaming results to eyeball that might like something to look at while the second (presumably longer) search is running.

Cheers,

Malcolm Cook
Stowers Institute for Medical Research - Kansas City, Missouri


> -----Original Message-----
> From: bioperl-l-bounces@...
> [mailto:bioperl-l-bounces@...] On Behalf Of
> Jonas Schaer
> Sent: Thursday, July 09, 2009 5:16 AM
> To: BioPerl List; Smithies, Russell
> Subject: Re: [Bioperl-l] cdd-search with remoteblast?
>
> Hi guys,
> Thank you all so much for your help and patience :). Of
> course you were right and I finaly found the right
> put-parameter to get exactly the same hits as on the homepage.
> I do have an other question though :)...
> I now want to include a search for conserved domains, but
> when I try to use the CDD_SEARCH-parameter
> (http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/new/node16.html#
> sub:CDD_SEARCH)
> like the other put-parameters the way chris once told
> me(works fine with the other params):
>
> my %put = (
>     WORD_SIZE => 3,
>     HITLIST_SIZE => 100,
>     THRESHOLD => 11,
>     FILTER => 'R',
>     GENETIC_CODE => 1,
>     CDD_SEARCH => 'on'
> ###I tried it
> with 'true' and '1', too.
>
> );
>
> for my $putName (keys %put) {
>     $factory->submit_parameter($putName,$put{$putName});
> }
>
>
> ...an exception is thrown:
>
> ------------- EXCEPTION: Bio::Root::Exception -------------
> MSG: CDD_SEARCH is not a valid PUT parameter.
> STACK: Error::throw
> STACK: Bio::Root::Root::throw C:/Perl/site/lib/Bio/Root/Root.pm:359
> STACK: Bio::Tools::Run::RemoteBlast::submit_parameter
> C:/Perl/site/lib/Bio/Tools
> /Run/RemoteBlast.pm:325
> STACK: main::blast_a_sequence firsteval0.8.pm:383
> STACK: main::blast_it firsteval0.8.pm:288
> STACK: firsteval0.8.pm:35
> ----------------------------------------------------------- .
> I guess somehow this could be the solution to my problem:
> http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/new/node78.html#s
> ub:RID-for-Simultaneous
> , but unfortunately I don't understand what to do.
> I'm so sorry to bother you with this but please help me once more...:)
>
> Best regards and thanks in advance,
> Jonas
>
> ----- Original Message -----
> From: "Smithies, Russell" <Russell.Smithies@...>
> To: "'Jonas Schaer'" <Brotelzwieb@...>
> Cc: "'Chris Fields'" <cjfields@...>; "'BioPerl List'"
> <bioperl-l@...>
> Sent: Monday, July 06, 2009 10:56 PM
> Subject: RE: [Bioperl-l] different results with remote-blast skript
>
>
> Hi Jonas,
> You can't just play with the BLAST parameters and hope for a "better"
> result.
> I'd suggest that if you aren't sure what they do, you should
> leave them
> alone as small changes can make huge differences in the
> output - it's quite
> possible to miss finding what you're looking for by using the wrong
> parameters.
> If all else fails, read the blast manual:
> http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/blastall/blastall
> _all.html
> http://www.ncbi.nlm.nih.gov/blast/tutorial/
> Or Read Ian Korfs' excellent book:
> http://books.google.com/books?id=xvcnhDG9fNUC&lpg=PR17&ots=WJp
fuHF6Hn&dq=ian%20korf%20%20blast%20book&pg=PA3

>
> Don't worry about the integer overflow bug as there's nothing
> you can do
> about it. If you're interested, Google and Wikipedia are your
> friends:
> http://en.wikipedia.org/wiki/Integer_overflow
>
>
> Russell
>
> > -----Original Message-----
> > From: bioperl-l-bounces@... [mailto:bioperl-l-
> > bounces@...] On Behalf Of Jonas Schaer
> > Sent: Tuesday, 7 July 2009 12:14 a.m.
> > To: BioPerl List; Chris Fields
> > Subject: Re: [Bioperl-l] different results with remote-blast skript
> >
> > Hi guys, thanks for your answers so far.
> > @jason: integer overflow in blast.... sorry, but what do
> you mean by that?
> > how can I fix it...?
> >
> > Since I never really changed any parameters I thought them
> all to be
> > default.
> > whatever, I tried to get "better" results with my prog by changing
> > these:
> > $Bio::Tools::Run::RemoteBlast::HEADER{'GAPCOSTS'} = '11 1';
> > $Bio::Tools::Run::RemoteBlast::HEADER{'MAX_NUM_SEQ'} = '100';
> > $Bio::Tools::Run::RemoteBlast::HEADER{'EXPECT'} = '10';
> >
> $Bio::Tools::Run::RemoteBlast::HEADER{'COMPOSITION_BASED_STATI
> STICS'} =
> > '1';
> > with no effect...I guess these were default values anyway.
> >
> > So please maybe you can tell me all the other parameters I
> can change with
> > my
> > perl-skript AND how to do that?
> > Unfortunately both, perl and the blast-algorithm are pretty
> much new to
> > me,
> > maybe thats why I just cannot find out how to do that on my
> own... :/
> >
> > Here is the output I get with my remote-blast skript:
> >
> ##############################################################
> ################
> > ###################################
> >  Query Name:
> > MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDSDLGLLRSL
> > L
> >         hit name is ref|XP_001702807.1|
> >                 score is 442
> > BLASTP 2.2.21+
> > Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro
> A. Schaffer,
> > Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
> Lipman (1997),
> > "Gapped
> > BLAST and PSI-BLAST: a new generation of protein database search
> > programs",
> > Nucleic Acids Res. 25:3389-3402.
> >
> >
> > Reference for composition-based statistics: Alejandro A.
> > Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin,
> John L. Spouge,
> > Yuri
> > I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
> "Improving the
> > accuracy of PSI-BLAST protein database searches with
> composition-based
> > statistics and other refinements", Nucleic Acids Res. 29:2994-3005.
> >
> >
> > RID: 53STX5G2013
> >
> >
> > Database: All non-redundant GenBank CDS
> > translations+PDB+SwissProt+PIR+PRF excluding environmental samples
> > from WGS projects
> >            9,252,587 sequences; 3,169,972,781 total letters Query=
> >
> MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDSDLGLLRSLL
> >
> DVAGVDRTALEVKLLALAEAGAEMPPAQDSQATAAGVVATLTSVYRQQVARAWHERDDNAFRQAHQNTAM
> > ATGPDPDDEYE
> > Length=150
> >
> >
> >
>        Score
> > E
> > Sequences producing significant alignments:
>       (Bits)
> > Value
> >
> > ref|XP_001702807.1|  ClpS-like protein [Chlamydomonas
> reinhard...   174
> > 2e-42
> >
> >
> > ALIGNMENTS
> > >ref|XP_001702807.1| ClpS-like protein [Chlamydomonas reinhardtii]
> >  gb|EDP06586.1| ClpS-like protein [Chlamydomonas reinhardtii]
> > Length=303
> >
> >  Score =  174 bits (442),  Expect = 2e-42, Method:
> Composition-based
> > stats.
> >  Identities = 150/150 (100%), Positives = 150/150 (100%),
> Gaps = 0/150
> > (0%)
> >
> > Query  1
> MGSSSVGTYHLLLVLMgaggeqqavqagaevaSTEQVDGSGMAANSRGSTSGSEQPPrds
> > 60
> >
> MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDS
> > Sbjct  154
> MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDS
> > 213
> >
> > Query  61
> dlgllrslldVAGVDRTalevkllalaeagaeMPPAQDSQATAAGVVATLTSVYRQQVAR
> > 120
> >
> DLGLLRSLLDVAGVDRTALEVKLLALAEAGAEMPPAQDSQATAAGVVATLTSVYRQQVAR
> > Sbjct  214
> DLGLLRSLLDVAGVDRTALEVKLLALAEAGAEMPPAQDSQATAAGVVATLTSVYRQQVAR
> > 273
> >
> > Query  121  AWHERDDNAFRQAHQNTAMATGPDPDDEYE  150
> >             AWHERDDNAFRQAHQNTAMATGPDPDDEYE
> > Sbjct  274  AWHERDDNAFRQAHQNTAMATGPDPDDEYE  303
> >
> >
> >
> >   Database: All non-redundant GenBank CDS
> > translations+PDB+SwissProt+PIR+PRF
> > excluding environmental samples from WGS projects
> >     Posted date:  Jul 5, 2009  4:41 AM
> >   Number of letters in database: -1,124,994,511
> >   Number of sequences in database:  9,252,587
> >
> > Lambda     K      H
> >    0.309    0.122    0.345
> > Gapped
> > Lambda     K      H
> >    0.267   0.0410    0.140
> > Matrix: BLOSUM62
> > Gap Penalties: Existence: 11, Extension: 1
> > Number of Sequences: 9252587
> > Number of Hits to DB: 60273703
> > Number of extensions: 1448367
> > Number of successful extensions: 2103
> > Number of sequences better than 10: 0
> > Number of HSP's better than 10 without gapping: 0
> > Number of HSP's gapped: 2113
> > Number of HSP's successfully gapped: 0
> > Length of query: 150
> > Length of database: 3169972781
> > Length adjustment: 113
> > Effective length of query: 37
> > Effective length of database: 2124430450
> > Effective search space: 78603926650
> > Effective search space used: 78603926650
> > T: 11
> > A: 40
> > X1: 16 (7.1 bits)
> > X2: 38 (14.6 bits)
> > X3: 64 (24.7 bits)
> > S1: 42 (20.8 bits)
> > S2: 74 (33.1 bits)
> >
> >
> ##############################################################
> ################
> > ###################################
> > and here are the hits (?) of the blast-algorithm on the
> ncbi-homepage with
> > the same query of course:
> > ref|XP_001702807.1|  ClpS-like protein [Chlamydomonas
> reinhard...   300
> > 3e-80
> > ref|XP_001942719.1|  PREDICTED: similar to GA16705-PA
> [Acyrtho...  36.2
> > 1.1
> > ref|ZP_03781446.1|  hypothetical protein RUMHYD_00880
> [Blautia...  35.4
> > 1.8
> > ref|XP_001563232.1|  leucyl-tRNA synthetase [Leishmania
> brazil...  34.3
> > 4.2
> > ref|XP_680841.1|  hypothetical protein AN7572.2
> [Aspergillus n...  33.5
> > 6.0
> > ref|YP_001768110.1|  hypothetical protein M446_1150
> [Methyloba...  33.5
> > 7.0
> >
> ##############################################################
> ################
> > ###################################at
> > least the first hit is the same, but even there there is a
> different score
> > and e-value.
> >
> > thanks so much for any help :)
> > regards, jonas
> >
> >
> > ----- Original Message -----
> > From: "Chris Fields" <cjfields@...>
> > To: "Jason Stajich" <jason@...>
> > Cc: "Smithies, Russell"
> <Russell.Smithies@...>; "'BioPerl
> > List'" <bioperl-l@...>; "'Jonas Schaer'"
> > <Jonas_Schaer@...>
> > Sent: Monday, July 06, 2009 12:51 AM
> > Subject: Re: [Bioperl-l] different results with remote-blast skript
> >
> >
> > > That inspires confidence ;>
> > >
> > > chris
> > >
> > > On Jul 5, 2009, at 4:40 PM, Jason Stajich wrote:
> > >
> > >> integer overflow in blast....
> > >>
> > >> On Jul 5, 2009, at 2:00 PM, Smithies, Russell wrote:
> > >>
> > >>> I'd guess it's a difference in the parameters used.
> > >>> Interesting that both have the number of letters in the db as
> > >>> "-1,125,070,205", I assume that's a bug  :-)
> > >>>
> > >>> Stats from your remote_blast:
> > >>>
> > >>> 'stats' => {
> > >>>            'S1' => '42',
> > >>>            'S1_bits' => '20.8',
> > >>>            'lambda' => '0.309',
> > >>>            'entropy' => '0.345',
> > >>>            'kappa_gapped' => '0.0410',
> > >>>            'T' => '11',
> > >>>            'kappa' => '0.122',
> > >>>            'X3_bits' => '24.7',
> > >>>            'X1' => '16',
> > >>>            'lambda_gapped' => '0.267',
> > >>>            'X2' => '38',
> > >>>            'S2' => '74',
> > >>>            'seqs_better_than_cutoff' => '0',
> > >>>            'posted_date' => 'Jul 4, 2009  4:41 AM',
> > >>>            'Hits_to_DB' => '60102303',
> > >>>            'dbletters' => '-1125070205',
> > >>>            'A' => '40',
> > >>>            'num_successful_extensions' => '2004',
> > >>>            'num_extensions' => '1436892',
> > >>>            'X1_bits' => '7.1',
> > >>>            'X3' => '64',
> > >>>            'entropy_gapped' => '0.140',
> > >>>            'dbentries' => '9252258',
> > >>>            'X2_bits' => '14.6',
> > >>>            'S2_bits' => '33.1'
> > >>>          }
> > >>>
> > >>>
> > >>> Stats from a blast done on the NCBI webpage:
> > >>>
> > >>> Database: All non-redundant GenBank CDS
> translations+PDB+SwissProt
> > >>> +PIR+PRF
> > >>> excluding environmental samples from WGS projects
> > >>>   Posted date:  Jul 4, 2009  4:41 AM
> > >>> Number of letters in database: -1,125,070,205
> > >>> Number of sequences in database:  9,252,258
> > >>>
> > >>> Lambda     K      H
> > >>>  0.309    0.124    0.340
> > >>> Gapped
> > >>> Lambda     K      H
> > >>>  0.267   0.0410    0.140
> > >>> Matrix: BLOSUM62
> > >>> Gap Penalties: Existence: 11, Extension: 1
> > >>> Number of Sequences: 9252258
> > >>> Number of Hits to DB: 86493230
> > >>> Number of extensions: 3101413
> > >>> Number of successful extensions: 9001
> > >>> Number of sequences better than 100: 65
> > >>> Number of HSP's better than 100 without gapping: 0
> > >>> Number of HSP's gapped: 9000
> > >>> Number of HSP's successfully gapped: 66
> > >>> Length of query: 150
> > >>> Length of database: 3169897087
> > >>> Length adjustment: 113
> > >>> Effective length of query: 37
> > >>> Effective length of database: 2124391933
> > >>> Effective search space: 78602501521
> > >>> Effective search space used: 78602501521
> > >>> T: 11
> > >>> A: 40
> > >>> X1: 16 (7.1 bits)
> > >>> X2: 38 (14.6 bits)
> > >>> X3: 64 (24.7 bits)
> > >>> S1: 42 (20.8 bits)
> > >>> S2: 65 (29.6 bits)
> > >>>
> > >>>
> > >>>> -----Original Message-----
> > >>>> From: bioperl-l-bounces@... [mailto:bioperl-l-
> > >>>> bounces@...] On Behalf Of Jonas Schaer
> > >>>> Sent: Sunday, 28 June 2009 10:15 p.m.
> > >>>> To: BioPerl List
> > >>>> Subject: [Bioperl-l] different results with remote-blast skript
> > >>>>
> > >>>> Hi again :)
> > >>>> please, I only have this little question:
> > >>>> why do I get different results with my remote::blast
> perl skript
> > >>>> then on the
> > >>>> ncbi blast homepage?
> > >>>> I am using blastp, the query is an amino-sequence (different
> > >>>> results with any
> > >>>> sequence, differences not only in number of hits but even in e-
> > >>>> values, scores
> > >>>> etc...), the database is 'nr'.
> > >>>> PLEASE help me,
> > >>>> thank you in advance,
> > >>>> Jonas
> > >>>>
> > >>>> ps: my skript:
> > >>>>
> >
> ##############################################################
> ################
> > >>>> ##
> > >>>> use Bio::Seq::SeqFactory;
> > >>>> use Bio::Tools::Run::RemoteBlast;
> > >>>> use strict;
> > >>>> my @blast_report;
> > >>>> my $prog = 'blastp';
> > >>>> my $db   = 'nr';
> > >>>> my $e_val= '1e-10';
> > >>>> #my $e_val= '10';
> > >>>> my @params = ( '-prog' => $prog,
> > >>>>        '-data' => $db,
> > >>>>        '-expect' => $e_val,
> > >>>>        '-readmethod' => 'SearchIO' );
> > >>>> my $factory = Bio::Tools::Run::RemoteBlast->new(@params);
> > >>>>  $Bio::Tools::Run::RemoteBlast::HEADER{'GAPCOSTS'} = '11 1';
> > >>>>  $Bio::Tools::Run::RemoteBlast::HEADER{'MAX_NUM_SEQ'} = '100';
> > >>>> $Bio::Tools::Run::RemoteBlast::HEADER{'EXPECT'} = '10';
> > >>>> $
> > >>>> Bio
> > >>>>
> ::Tools::Run::RemoteBlast::HEADER{'COMPOSITION_BASED_STATISTICS'}
> > >>>> = '1';
> > >>>>
> > >>>> my
> > >>>> $
> > >>>> blast_seq
> > >>>>
> ='MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDSDLGLLR
> > >>>>
> >
> SLLDVAGVDRTALEVKLLALAEAGAEMPPAQDSQATAAGVVATLTSVYRQQVARAWHERDDN
> AFRQAHQNTAMATGPD
> > >>>> PDDEYE';
> > >>>> #$v is just to turn on and off the messages
> > >>>> my $v = 1;
> > >>>> my $seqbuilder = Bio::Seq::SeqFactory->new('-type' =>
> > >>>> 'Bio::PrimarySeq');
> > >>>> my $seq = $seqbuilder->create(-seq =>$blast_seq, -display_id =>
> > >>>> "$blast_seq");
> > >>>> my $filename='temp2.out';
> > >>>> my $r = $factory->submit_blast($seq);
> > >>>> print STDERR "waiting..." if( $v > 0 );
> > >>>>   while ( my @rids = $factory->each_rid )
> > >>>>   {
> > >>>>       foreach my $rid ( @rids )
> > >>>>       {
> > >>>>           my $rc = $factory->retrieve_blast($rid);
> > >>>>           if( !ref($rc) )
> > >>>>           {
> > >>>>               if( $rc < 0 )
> > >>>>               {
> > >>>>                   $factory->remove_rid($rid);
> > >>>>               }
> > >>>>               print STDERR "." if ( $v > 0 );
> > >>>>           }
> > >>>>               else
> > >>>>               {
> > >>>>                   my $result = $rc->next_result();
> > >>>>                   $factory->save_output($filename);
> > >>>>                   $factory->remove_rid($rid);
> > >>>>                   print "\nQuery Name: ",
> $result->query_name(),
> > >>>> "\n";
> > >>>>                   while ( my $hit = $result->next_hit )
> > >>>>                   {
> > >>>>                       next unless ( $v > 0);
> > >>>>                       print "\thit name is ", $hit->name, "\n";
> > >>>>                       while( my $hsp = $hit->next_hsp )
> > >>>>                       {
> > >>>>                           print "\t\tscore is ",
> $hsp->score, "\n";
> > >>>>                       }
> > >>>>                   }
> > >>>>               }
> > >>>>       }
> > >>>>
> > >>>>
> > >>>>   }
> > >>>> @blast_report = get_file_data ($filename);
> > >>>> return @blast_report;
> > >>>>
> >
> ##############################################################
> ################
> > >>>> ####
> > >>>> _______________________________________________
> > >>>> Bioperl-l mailing list
> > >>>> Bioperl-l@...
> > >>>> http://lists.open-bio.org/mailman/listinfo/bioperl-l
> > >>> =
> > >>> =
> > >>>
> =====================================================================
> > >>> Attention: The information contained in this message and/or
> > >>> attachments
> > >>> from AgResearch Limited is intended only for the
> persons or entities
> > >>> to which it is addressed and may contain confidential and/or
> > >>> privileged
> > >>> material. Any review, retransmission, dissemination or other use
> > >>> of, or
> > >>> taking of any action in reliance upon, this information
> by persons or
> > >>> entities other than the intended recipients is prohibited by
> > >>> AgResearch
> > >>> Limited. If you have received this message in error,
> please notify
> > >>> the
> > >>> sender immediately.
> > >>> =
> > >>> =
> > >>>
> =====================================================================
> > >>>
> > >>> _______________________________________________
> > >>> Bioperl-l mailing list
> > >>> Bioperl-l@...
> > >>> http://lists.open-bio.org/mailman/listinfo/bioperl-l
> > >>
> > >> --
> > >> Jason Stajich
> > >> jason@...
> > >>
> > >> _______________________________________________
> > >> Bioperl-l mailing list
> > >> Bioperl-l@...
> > >> http://lists.open-bio.org/mailman/listinfo/bioperl-l
> >
> >
> >
> --------------------------------------------------------------
> ----------------
> > --
> >
> >
> >
> > No virus found in this incoming message.
> > Checked by AVG - www.avg.com
> > Version: 8.5.375 / Virus Database: 270.13.5/2219 - Release
> Date: 07/05/09
> > 05:53:00
>
>
> --------------------------------------------------------------
> ------------------
>
>
>
> No virus found in this incoming message.
> Checked by AVG - www.avg.com
> Version: 8.5.375 / Virus Database: 270.13.5/2220 - Release
> Date: 07/05/09
> 17:54:00
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@...
> http://lists.open-bio.org/mailman/listinfo/bioperl-l
>

_______________________________________________
Bioperl-l mailing list
Bioperl-l@...
http://lists.open-bio.org/mailman/listinfo/bioperl-l

 « Return to Thread: different results with remote-blast skript