« Return to Thread: different results with remote-blast skript

different results with remote-blast skript

by Jonas Schaer :: Rate this Message:

Reply to Author | View in Thread

Hi again :)
please, I only have this little question:
why do I get different results with my remote::blast perl skript then on the ncbi blast homepage?
I am using blastp, the query is an amino-sequence (different results with any sequence, differences not only in number of hits but even in e-values, scores etc...), the database is 'nr'.
PLEASE help me,
thank you in advance,
Jonas

ps: my skript:
################################################################################
use Bio::Seq::SeqFactory;
  use Bio::Tools::Run::RemoteBlast;
  use strict;
  my @blast_report;
  my $prog = 'blastp';
  my $db   = 'nr';
  my $e_val= '1e-10';
  #my $e_val= '10';
  my @params = ( '-prog' => $prog,
         '-data' => $db,
         '-expect' => $e_val,
         '-readmethod' => 'SearchIO' );
  my $factory = Bio::Tools::Run::RemoteBlast->new(@params);
   $Bio::Tools::Run::RemoteBlast::HEADER{'GAPCOSTS'} = '11 1';
   $Bio::Tools::Run::RemoteBlast::HEADER{'MAX_NUM_SEQ'} = '100';
 $Bio::Tools::Run::RemoteBlast::HEADER{'EXPECT'} = '10';
$Bio::Tools::Run::RemoteBlast::HEADER{'COMPOSITION_BASED_STATISTICS'} = '1';
 
  my $blast_seq='MGSSSVGTYHLLLVLMGAGGEQQAVQAGAEVASTEQVDGSGMAANSRGSTSGSEQPPRDSDLGLLRSLLDVAGVDRTALEVKLLALAEAGAEMPPAQDSQATAAGVVATLTSVYRQQVARAWHERDDNAFRQAHQNTAMATGPDPDDEYE';
  #$v is just to turn on and off the messages
  my $v = 1;
  my $seqbuilder = Bio::Seq::SeqFactory->new('-type' => 'Bio::PrimarySeq');  
  my $seq = $seqbuilder->create(-seq =>$blast_seq, -display_id => "$blast_seq");
  my $filename='temp2.out';
  my $r = $factory->submit_blast($seq);
  print STDERR "waiting..." if( $v > 0 );
    while ( my @rids = $factory->each_rid )
    {
        foreach my $rid ( @rids )
        {
            my $rc = $factory->retrieve_blast($rid);
            if( !ref($rc) )
            {
                if( $rc < 0 )
                {
                    $factory->remove_rid($rid);
                }
                print STDERR "." if ( $v > 0 );
            }
                else    
                {
                    my $result = $rc->next_result();
                    $factory->save_output($filename);
                    $factory->remove_rid($rid);
                    print "\nQuery Name: ", $result->query_name(), "\n";
                    while ( my $hit = $result->next_hit )
                    {
                        next unless ( $v > 0);
                        print "\thit name is ", $hit->name, "\n";
                        while( my $hsp = $hit->next_hsp )
                        {
                            print "\t\tscore is ", $hsp->score, "\n";
                        }
                    }
                }
        }
   
   
    }
@blast_report = get_file_data ($filename);
return @blast_report;
##################################################################################
_______________________________________________
Bioperl-l mailing list
Bioperl-l@...
http://lists.open-bio.org/mailman/listinfo/bioperl-l

 « Return to Thread: different results with remote-blast skript